PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0049s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 529aa    MW: 57854.6 Da    PI: 5.563
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0049s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.95.6e-34298352155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+F+eav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Kalax.0049s0090.1.p 298 KQRMRWTPELHEAFIEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 352
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.597295355IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-31296354IPR009057Homeodomain-like
SuperFamilySSF466891.25E-17297352IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-25298352IPR006447Myb domain, plants
PfamPF002493.9E-10300351IPR001005SANT/Myb domain
PfamPF143799.3E-26383430IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MLILVTFCIM CVNFVHIVLV ISTGKLTISS LGVRMDAPHM SIYGSGAKQH LGVSAACSSS  60
LPIIPTHLQE TFPKHSDPQQ IYMGREVITG SMARHNNSLP SHSGAAGHII SSPSGYSTSL  120
RFSSVSVHEK QPSNSLFITQ SSFDRKAMLS ANSNGSGKLQ SDTLMQYPSE SENSSWCADS  180
LQGFLDFRTP LDENHLESTV SGTASVELAK QNDWQEWADH FITDDDALNT NWSDLLIDAT  240
VESLEPEIAY QVPKPPSDAA IQQPQVQPQA QLLLHPASSC ETVVLPVPAS SSSNSAAKQR  300
MRWTPELHEA FIEAVNQLGG SERATPKGVL KLMKVEGLTI YHVKSHLQKY RTARYRPDPS  360
EATSLRNVTP IEEFSSLDLK TGIEITEALR LQMEVQKRLH EQLEIQRNLQ LRIEEQGRYL  420
QMMFEKQCKS VPDSDKLKTS SSTIENASAL SAPVSSGNGK TEETSELDAS KAVNVLVQSV  480
APESEASGNK VGEKRRSPDT EEGSDNTEHD DASHSQQKRA KNNDEGSV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270511.11e-167PREDICTED: protein PHR1-LIKE 1
TrEMBLF6HZP91e-167F6HZP9_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g04120.t011e-167(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-98phosphate starvation response 1